McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC2L-3:1

Chromosome

chr16

Gene Name

lnc-TRAPPC2L-3

Start

88870741

CPC Label

noncoding

End

88874854

Cancer

OV

Strand

+

Peptide

VAWCMVGGYAGQMAFIFGSR

Modified Peptide

n[145]VAWCMVGGYAGQMAFIFGSR

Peptide Length

20

ORF Length

164

Open Reading Frame (ORF)

LGRSCLASRDSANTRPGFPDTLHPGHPLLLSPGLSFPSCPDSLWPSATGLHLPGLWPGPHASFALVLRVAWCMVGGYAGQMAFIFGSRADPFPRSEVTGPVSPSALWSGPWRLLARSMQPAGAHATVPGTPVCTQRRIQGGEGKRGGFCPQSKLVSPPRSPPQS

Conservation Score

0.448

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.450755

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9133

PhyloCSF Frame 3

0

CNTI Score

-0.270383746