McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC12-1:2

Chromosome

chr2

Gene Name

lnc-TRAPPC12-1

Start

3519580

CPC Label

noncoding

End

3524367

Cancer

HCC

Strand

+

Peptide

QLTLELPEILQEK

Modified Peptide

n[230]QLTLELPEILQEK

Peptide Length

13

ORF Length

43

Open Reading Frame (ORF)

MQLTLELPEILQEKYTLISFLFPCSNGFANTSSLESLPLHLFT

Conservation Score

0.042

PhyloCSF Frame 1

-2.925

No. of Spectra

45

CPC Coding Probability

0.224879

PhyloCSF Frame 2 

-3.339

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-3.729

CNTI Score

-0.334639396