McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC11-4:1

Chromosome

chr4

Gene Name

lnc-TRAPPC11-4

Start

184019302

CPC Label

noncoding

End

184023524

Cancer

LUAD

Strand

+

Peptide

AALGSPSCK

Modified Peptide

n[230]AALGSPSCK

Peptide Length

9

ORF Length

77

Open Reading Frame (ORF)

LRSPPISVLCSSGKLIMKYTCSSSSTSFPPRSSFPFSHLDTDTPPRFPHWKGRTLCSIVHTCWVRNRAALGSPSCKY

Conservation Score

1

PhyloCSF Frame 1

-1.558

No. of Spectra

3

CPC Coding Probability

0.0743991

PhyloCSF Frame 2 

-4.301

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-2.201

CNTI Score

-0.371549494