McDonnell Genome Institute

Washington University

Transcript

lnc-TRAM1-1:1

Chromosome

chr8

Gene Name

lnc-TRAM1-1

Start

70525093

CPC Label

noncoding

End

70536488

Cancer

OV

Strand

-

Peptide

IFQCPINVYK

Modified Peptide

n[145]IFQCPINVYK

Peptide Length

10

ORF Length

95

Open Reading Frame (ORF)

MIFQCPINVYKSTLFPYQRNAYHFNVITITISPEWLELKGLATQMQKMPATGTFFFPQMESCSVTQTRVQWCYLSSLQPPPLRFKQFSCLSLPSS

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0754215

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8981

PhyloCSF Frame 3

0

CNTI Score

-0.355286505