McDonnell Genome Institute

Washington University

Transcript

lnc-TRAK1-8:1

Chromosome

chr3

Gene Name

lnc-TRAK1-8

Start

42340587

CPC Label

noncoding

End

42342367

Cancer

OV

Strand

+

Peptide

SADLHLSQR

Modified Peptide

n[145]SADLHLSQR

Peptide Length

9

ORF Length

79

Open Reading Frame (ORF)

MNVQKSKVGTRAVVQEMEGTKTAGGSQTGKMAKKIKSADLHLSQRNLRKIQPPSSVLQASVLLSLLMVKMKRKEQITPN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.162829

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9874

PhyloCSF Frame 3

0

CNTI Score

-0.308488165