McDonnell Genome Institute

Washington University

Transcript

lnc-TRAK1-4:1

Chromosome

chr3

Gene Name

lnc-TRAK1-4

Start

41977007

CPC Label

coding

End

41978034

Cancer

EOGC

Strand

+

Peptide

LCADGAVGSATVESPGVDSAQGR

Modified Peptide

n[145]LCADGAVGSATVESPGVDSAQGR

Peptide Length

23

ORF Length

172

Open Reading Frame (ORF)

LKTMVWIPAESAMEELMPWLLPVELCNLMEGFDPSVPLRTPQECLRWVQIQAAQCPDVVVAQIDPKKLKRKQSVNIFLSGCQPATEGYSPTLRWQQQQVALFSTVRQNVNKHRSHWKSQQLDSNVTMPESEDEEGWKKFSLGEKLCADGAVGSATVESPGVDSAQGRCFMLY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.991853

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0638

PhyloCSF Frame 3

0

CNTI Score

0.523542066