McDonnell Genome Institute

Washington University

Transcript

lnc-TRAF6-3:1

Chromosome

chr11

Gene Name

lnc-TRAF6-3

Start

36440348

CPC Label

noncoding

End

36444021

Cancer

EOGC

Strand

-

Peptide

ATGLHPEPGK

Modified Peptide

n[145]ATGLHPEPGK

Peptide Length

10

ORF Length

182

Open Reading Frame (ORF)

LLPTSQFLWLQQWLKVPQVPFQLLLWREQAISLGGFHIVLSLQVHRVQEKEALQLPPRFQKMYRKAWVPKQKPTTGVEPPQRDSTRAVPRGYVGLEPLTLPSGAVGRGFLPSRPKKGRATGLHPEPGKTTGTQLQSVRADPGAGTLQSHRGRAAQGLGSPSFASVCPGCGTWGQRLFWSFKI

Conservation Score

0.717

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.156001

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.343743207