McDonnell Genome Institute

Washington University

Transcript

lnc-TRABD2B-5:1

Chromosome

chr1

Gene Name

lnc-TRABD2B-5

Start

47709857

CPC Label

noncoding

End

47710094

Cancer

HCC

Strand

-

Peptide

MLSPTPPGPR

Modified Peptide

n[230]MLSPTPPGPR

Peptide Length

10

ORF Length

46

Open Reading Frame (ORF)

LGERASAAGCWRVASNLPQTPGCSGGQNSRRSLGARMLSPTPPGPR

Conservation Score

0.443

PhyloCSF Frame 1

-2.524

No. of Spectra

11

CPC Coding Probability

0.0242855

PhyloCSF Frame 2 

-3.417

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

-3.749

CNTI Score

-0.324907863