McDonnell Genome Institute

Washington University

Transcript

lnc-TRA2A-7:1

Chromosome

chr7

Gene Name

lnc-TRA2A-7

Start

23721310

CPC Label

noncoding

End

23721782

Cancer

CCRC

Strand

-

Peptide

LACIYIR

Modified Peptide

n[230]LACIYIR

Peptide Length

7

ORF Length

101

Open Reading Frame (ORF)

LACIYIRRTLRNFINDEMQAKGIPQRAPPKRKKKKRVKQRTNTYIFVGNQLIPQPLDREEDEKMEDNKEEEEKDHSEAMKPEEPPQNLLRKKSQRCPFLNL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.213307

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8374

PhyloCSF Frame 3

0

CNTI Score

-0.353437468