McDonnell Genome Institute

Washington University

Transcript

lnc-TPTE2-5:1

Chromosome

chr13

Gene Name

lnc-TPTE2-5

Start

19304592

CPC Label

coding

End

19305625

Cancer

CCRC

Strand

-

Peptide

ELGLPSK

Modified Peptide

n[230]ELGLPSK

Peptide Length

7

ORF Length

186

Open Reading Frame (ORF)

LEFYRELGLPSKQTVIIFNVTDNAAIKPGTPLYAAHFCPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGDISTGDIGRVWPGTKMPGKMGNIYRTVYGLKVWRINTKHNIIYVNGSVPGHKNCLVRVRDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPSVPSIMF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.862474

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9619

PhyloCSF Frame 3

0

CNTI Score

-0.374689027