McDonnell Genome Institute

Washington University

Transcript

lnc-TPTE2-4:1

Chromosome

chr13

Gene Name

lnc-TPTE2-4

Start

19563967

CPC Label

noncoding

End

19564879

Cancer

CCRC

Strand

-

Peptide

NEEPSSNHILHGK

Modified Peptide

n[230]NEEPSSNHILHGK

Peptide Length

13

ORF Length

139

Open Reading Frame (ORF)

LRAQHEENIKKLVDQFLQEQKEEALKIQSNDGKELGINDQVVPKNIPKVAENVADKNEEPSSNHILHGKEQIKRGGDAGMPGIKKNDLAKVDDLPPALKKPPISVFQHESHQAISHLPTGQPLSPNMPPDSQVNHNGNP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0289271

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5162

PhyloCSF Frame 3

0

CNTI Score

0.700434633