McDonnell Genome Institute

Washington University

Transcript

lnc-TPT1-2:1

Chromosome

chr13

Gene Name

lnc-TPT1-2

Start

45347389

CPC Label

noncoding

End

45371856

Cancer

CRC

Strand

-

Peptide

LSLGAGDQPGQHGK

Modified Peptide

Peptide Length

14

ORF Length

39

Open Reading Frame (ORF)

LSLGAGDQPGQHGKTPSLQTVQKLAEYGGVTCSPTYLGG

Conservation Score

0.02

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0518036

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8243

PhyloCSF Frame 3

0

CNTI Score

-0.333322801