McDonnell Genome Institute

Washington University

Transcript

lnc-TPST1-1:5

Chromosome

chr7

Gene Name

lnc-TPST1-1

Start

66494145

CPC Label

noncoding

End

66495468

Cancer

OV

Strand

+

Peptide

LMAVATTSKPLELCRGMPK

Modified Peptide

n[145]LMAVATTSKPLELCRGMPK

Peptide Length

19

ORF Length

34

Open Reading Frame (ORF)

LMAVATTSKPLELCRGMPKDLFKVFSVTPTVTWF

Conservation Score

0.988

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0197992

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8304

PhyloCSF Frame 3

0

CNTI Score

-0.493694011