McDonnell Genome Institute

Washington University

Transcript

lnc-TPST1-1:12

Chromosome

chr7

Gene Name

lnc-TPST1-1

Start

66493726

CPC Label

noncoding

End

66504420

Cancer

HCC

Strand

+

Peptide

ACNTHLCFFEGSR

Modified Peptide

n[230]ACNTHLCFFEGSR

Peptide Length

13

ORF Length

91

Open Reading Frame (ORF)

MIRMGVSCPFPDMRVSLAREPLPGTLLGQAPLPRACNTHLCFFEGSRDQAVRPRGPRPRWFGGLSLALGCLARPPPLEGLILSPAAPQLPC

Conservation Score

0.547

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.103048

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0776

PhyloCSF Frame 3

0

CNTI Score

-0.262399122