McDonnell Genome Institute

Washington University

Transcript

lnc-TPSG1-1:1

Chromosome

chr16

Gene Name

lnc-TPSG1-1

Start

1206559

CPC Label

noncoding

End

1207124

Cancer

BRCA-Luminal A

Strand

-

Peptide

HGVSGVCLQAELAAEK

Modified Peptide

n[145]HGVSGVCLQAELAAEK

Peptide Length

16

ORF Length

69

Open Reading Frame (ORF)

LEHGDDGPQQGVEVLPVRHGVSGVCLQAELAAEKAREPRPEAGQTEGSHSGFGWQLEPGTPASFSLSGL

Conservation Score

1

PhyloCSF Frame 1

-2.723

No. of Spectra

7

CPC Coding Probability

0.114038

PhyloCSF Frame 2 

-4.919

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

12.409

CNTI Score

-0.347791685