McDonnell Genome Institute

Washington University

Transcript

lnc-TPRA1-4:1

Chromosome

chr3

Gene Name

lnc-TPRA1-4

Start

127770568

CPC Label

noncoding

End

127777156

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LAFHAGR

Modified Peptide

n[145]LAFHAGR

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

LAFHAGRRASLTQRGQGGLREEGTHGPTQEALLRETDTQRQASIRHEVPASSPAKKGAGRLCSY

Conservation Score

0.505

PhyloCSF Frame 1

-4.043

No. of Spectra

1

CPC Coding Probability

0.126134

PhyloCSF Frame 2 

-4.721

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-5.076

CNTI Score

-0.28952075