McDonnell Genome Institute

Washington University

Transcript

lnc-TPP2-2:1

Chromosome

chr13

Gene Name

lnc-TPP2-2

Start

102679425

CPC Label

noncoding

End

102679958

Cancer

OV

Strand

+

Peptide

NINTCISILVTPSGLAR

Modified Peptide

n[145]NINTCISILVTPSGLAR

Peptide Length

17

ORF Length

54

Open Reading Frame (ORF)

MRNINTCISILVTPSGLARVQSLSMKATCMFSLTHSWTFTCTHIQVPICIGLVQ

Conservation Score

0.128

PhyloCSF Frame 1

-4.485

No. of Spectra

1

CPC Coding Probability

0.0322517

PhyloCSF Frame 2 

-3.945

CNTI Index

noncoding

Max Probability

0.0774

PhyloCSF Frame 3

-4.249

CNTI Score

-0.391825005