McDonnell Genome Institute

Washington University

Transcript

lnc-TPO-5:1

Chromosome

chr2

Gene Name

lnc-TPO-5

Start

1824411

CPC Label

coding

End

1828667

Cancer

HCC

Strand

+

Peptide

EASGLGAGK

Modified Peptide

n[230]EASGLGAGK

Peptide Length

9

ORF Length

100

Open Reading Frame (ORF)

LWVLREWPESQTFSLSPESNMELGKETSDTPLPCLPDGDRHREASGLGAGKVEELPMRLVLWQGKGPPRSCHLPQRCTWDEDGGEAPQRPSYGEQALTIQ

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.766135

PhyloCSF Frame 2 

-4.301

CNTI Index

noncoding

Max Probability

0.9337

PhyloCSF Frame 3

-4.526

CNTI Score

-0.31498587