McDonnell Genome Institute

Washington University

Transcript

lnc-TPO-12:1

Chromosome

chr2

Gene Name

lnc-TPO-12

Start

2298238

CPC Label

noncoding

End

2306115

Cancer

BRCA-Luminal A

Strand

+

Peptide

REAACLK

Modified Peptide

n[145]REAACLK

Peptide Length

7

ORF Length

135

Open Reading Frame (ORF)

LCSGSSQQAPLDRAHILEDTVLRTIHLPTETKRRRLTPNKPRAGRREAACLKMTTVHSCVIIETIAKDSHLPSQRTTYVTRHSRKNLPRLLLHTLKNIEQHVTSKCPDLTTVVPAAGSCQQSQDFCFVFLIRSVS

Conservation Score

0.236

PhyloCSF Frame 1

-4.245

No. of Spectra

3

CPC Coding Probability

0.121219

PhyloCSF Frame 2 

-3.445

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-3.432

CNTI Score

-0.383347174