McDonnell Genome Institute

Washington University

Transcript

lnc-TPM1-1:1

Chromosome

chr15

Gene Name

lnc-TPM1-1

Start

62953172

CPC Label

coding

End

62954124

Cancer

HCC

Strand

+

Peptide

EGAGNQGAGEQR

Modified Peptide

n[230]EGAGNQGAGEQR

Peptide Length

12

ORF Length

107

Open Reading Frame (ORF)

MEGAGNQGAGEQRRPMRQNMCWGYRPRFRRGPPRPKQPREDGNEEDKENQGGDTQGQQPPQRRYLRNFNYRRRRPENPKPQDGKETKAADPPVENSSTPEAEQGRLS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.983318

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8821

PhyloCSF Frame 3

0

CNTI Score

-0.290015048