McDonnell Genome Institute

Washington University

Transcript

lnc-TPI1-1:1

Chromosome

chr12

Gene Name

lnc-TPI1-1

Start

6884897

CPC Label

noncoding

End

6885684

Cancer

BRCA-Luminal B

Strand

+

Peptide

EILVGDVGVTISEPFK

Modified Peptide

n[145]EILVGDVGVTISEPFK

Peptide Length

16

ORF Length

154

Open Reading Frame (ORF)

MRVRKCSTPEEIKKRTKAVIFLSQCRQKVHHVEGKEILVGDVGVTISEPFKHFVGMLPEKDCCYALYDASFETKESRRIDVFLWASELAPLKSKMIYTSSKDAIKKKFQGIKHEWQTNGPEDLNRACTAEKLGGSFFFFFEMDGSLIVAFEGCP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.156902

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

0.532003186