McDonnell Genome Institute

Washington University

Transcript

lnc-TPH2-5:1

Chromosome

chr12

Gene Name

lnc-TPH2-5

Start

72610677

CPC Label

noncoding

End

72611316

Cancer

OV

Strand

+

Peptide

AHTRPSVALH

Modified Peptide

n[145]AHTRPSVALH

Peptide Length

10

ORF Length

68

Open Reading Frame (ORF)

MHFKRSSWLDWRRGAEFHKVTTEQYQKAAKERAAKFSDMSFVLSVLICRPKFFSVITRAHTRPSVALH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0428939

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6802

PhyloCSF Frame 3

0

CNTI Score

-0.332426889