McDonnell Genome Institute

Washington University

Transcript

lnc-TPGS2-11:1

Chromosome

chr18

Gene Name

lnc-TPGS2-11

Start

36692197

CPC Label

noncoding

End

36724858

Cancer

OV

Strand

-

Peptide

FDAVTEVHTAQSNTEILAGSTHGR

Modified Peptide

n[145]FDAVTEVHTAQSNTEILAGSTHGR

Peptide Length

24

ORF Length

51

Open Reading Frame (ORF)

LEESLMVTVYLQTYQRWRFDAVTEVHTAQSNTEILAGSTHGRGWKGPAQIP

Conservation Score

0.055

PhyloCSF Frame 1

-5.781

No. of Spectra

2

CPC Coding Probability

0.0865614

PhyloCSF Frame 2 

-4.771

CNTI Index

noncoding

Max Probability

0.3394

PhyloCSF Frame 3

-4.783

CNTI Score

-0.346347529