McDonnell Genome Institute

Washington University

Transcript

lnc-TPCN2-5:1

Chromosome

chr11

Gene Name

lnc-TPCN2-5

Start

69155909

CPC Label

noncoding

End

69159740

Cancer

OV

Strand

+

Peptide

DLLCSDPPFK

Modified Peptide

n[145]DLLCSDPPFK

Peptide Length

10

ORF Length

67

Open Reading Frame (ORF)

MEEGPGMLPRQPLPVQAGAPGWLREGSLGGARPKDLLCSDPPFKRATDTGVLVSRSRDHLGWDRPRV

Conservation Score

0.051

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0536763

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9354

PhyloCSF Frame 3

0

CNTI Score

-0.308355531