McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG5-5:3

Chromosome

chr20

Gene Name

lnc-TP53TG5-5

Start

45435061

CPC Label

noncoding

End

45439366

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

APHIELQK

Modified Peptide

n[145]APHIELQK

Peptide Length

8

ORF Length

154

Open Reading Frame (ORF)

LNQPPLHLERVGLMPKMGHHADIILRPKPTLSCGRDKTTTVSWSHATWHLVSPRKAPHIELQKLPFPRLTTRGRRTLRLGRALRRSCPDPRPRGAVKTHWASQGSAALRAANRKYLPPGQSARGLVVLRSWKAWTLRRRGIRRVCRQSQQLAPA

Conservation Score

0.368

PhyloCSF Frame 1

-3.499

No. of Spectra

48

CPC Coding Probability

0.201138

PhyloCSF Frame 2 

-3.826

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-4.007

CNTI Score

-0.309187427