McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3C-11:1

Chromosome

chr16

Gene Name

lnc-TP53TG3C-11

Start

32915073

CPC Label

noncoding

End

32915536

Cancer

CRC

Strand

+

Peptide

GLEWVGCIK

Modified Peptide

GLEWVGCIK

Peptide Length

9

ORF Length

94

Open Reading Frame (ORF)

LREALVQPGGSLRLSCAASGFTCSNAWMSWVRQAPGKGLEWVGCIKSKANGGTTDYAAPVKGRFTISRDDSKNTLYLQMISLKTEDTAVYYCTT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.153995

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6592

PhyloCSF Frame 3

0

CNTI Score

-0.361979485