McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-75:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-75

Start

35879035

CPC Label

noncoding

End

35879498

Cancer

CRC

Strand

-

Peptide

LEDIGWDLETVQALQACVHSQ

Modified Peptide

LEDIGWDLETVQALQACVHSQ

Peptide Length

21

ORF Length

55

Open Reading Frame (ORF)

LQLQLLQEDSGHGPPQAKANSVPGRSLALLQHLRLEDIGWDLETVQALQACVHSQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0124383

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8934

PhyloCSF Frame 3

0

CNTI Score

-0.434154002