McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-70:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-70

Start

35638622

CPC Label

noncoding

End

35645180

Cancer

HCC

Strand

-

Peptide

LLPSAPPAWPTR

Modified Peptide

n[230]LLPSAPPAWPTR

Peptide Length

12

ORF Length

106

Open Reading Frame (ORF)

LLPSAPPAWPTRTHKTPSHMLTGPRGLGSPVSEEQFNQPELSLQLVYHDLPTNPGWVRHQPGEQAWGQRARSRSLGVSLGLCTHPSPPGLSWGSEGPGFFCYRWLL

Conservation Score

1

PhyloCSF Frame 1

1.789

No. of Spectra

45

CPC Coding Probability

0.37647

PhyloCSF Frame 2 

-2.05

CNTI Index

coding

Max Probability

0.9972

PhyloCSF Frame 3

-2.363

CNTI Score

0.699967525