McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-63:3

Chromosome

chr16

Gene Name

lnc-TP53TG3-63

Start

35477413

CPC Label

noncoding

End

35480458

Cancer

OV

Strand

-

Peptide

TELVEFCLFPPK

Modified Peptide

n[145]TELVEFCLFPPK

Peptide Length

12

ORF Length

64

Open Reading Frame (ORF)

LGPSPCLLRRLNKFYRGKWSSQDDRGRNQSRAHMRETPRKGKSVPRTAAKTELVEFCLFPPKGK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.267087

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9525

PhyloCSF Frame 3

0

CNTI Score

-0.326596362