McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-40:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-40

Start

33938336

CPC Label

noncoding

End

33938799

Cancer

BRCA-Luminal A

Strand

-

Peptide

LSCAASGFTCSNAWMSWVR

Modified Peptide

n[145]LSCAASGFTCSNAWMSWVR

Peptide Length

19

ORF Length

110

Open Reading Frame (ORF)

LLLFLKVSSVRCSWWSLPEALVQPGGSLRLSCAASGFTCSNAWMSWVRQAPGKGLEWVGRIKSKANGGTTDYAAPVKGRFTISRVDSKNTLYLQMNSLKTEDTAVYYCTT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.162574

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.355950895