McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-4:2

Chromosome

chr16

Gene Name

lnc-TP53TG3-4

Start

32262909

CPC Label

noncoding

End

32265348

Cancer

OV

Strand

-

Peptide

EQNPHTPGMSQEPSEGHR

Modified Peptide

n[145]EQNPHTPGM[147]SQEPSEGHR

Peptide Length

18

ORF Length

78

Open Reading Frame (ORF)

LPPPVKKEQNPHTPGMSQEPSEGHRSSPQPPRYVGSSKAHACVLQAGAHARVCSLCSGWGTTASAGYPGAPMGKGRKW

Conservation Score

0.016

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0479445

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7999

PhyloCSF Frame 3

0

CNTI Score

-0.368593807