McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-37:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-37

Start

33858895

CPC Label

noncoding

End

33859352

Cancer

BRCA-Luminal B

Strand

-

Peptide

GLEWVSAIGAGGGTYYADSVK

Modified Peptide

n[145]GLEWVSAIGAGGGTYYADSVK

Peptide Length

21

ORF Length

80

Open Reading Frame (ORF)

LRLSCAGSGFTFSSYAMHWVRQAPGKGLEWVSAIGAGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0728317

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

0.599989508