McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-34:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-34

Start

33687329

CPC Label

coding

End

33698504

Cancer

BRCA-Luminal B

Strand

-

Peptide

TEFEDQDDEAR

Modified Peptide

n[145]TEFEDQDDEAR

Peptide Length

11

ORF Length

124

Open Reading Frame (ORF)

LNRTEFEDQDDEARVPYEGFRPGVYVRVEIENVPCEFVQNFDPHYPIILGGLGNSEGNVGDVQMHLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIEDHNGRQRLLKYTPQHMHCGAAFWA

Conservation Score

1

PhyloCSF Frame 1

7.825

No. of Spectra

1

CPC Coding Probability

0.817761

PhyloCSF Frame 2 

-4.953

CNTI Index

noncoding

Max Probability

0.9555

PhyloCSF Frame 3

-4.562

CNTI Score

-0.289477085