McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-33:4

Chromosome

chr16

Gene Name

lnc-TP53TG3-33

Start

33562648

CPC Label

noncoding

End

33564346

Cancer

LUAD

Strand

-

Peptide

MALLFIYLR

Modified Peptide

n[230]MALLFIYLR

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

MALLFIYLRWSLTLLPSLKCSGASLAHCNLCFPDSSDSRASAS

Conservation Score

0.074

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0230755

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

0

CNTI Score

-0.357681081