McDonnell Genome Institute

Washington University

Transcript

lnc-TP53TG3-14:1

Chromosome

chr16

Gene Name

lnc-TP53TG3-14

Start

32475050

CPC Label

noncoding

End

32478250

Cancer

BRCA-Basal-like

Strand

-

Peptide

LGSASRLSLTEEK

Modified Peptide

n[145]LGSASRLSLTEEK

Peptide Length

13

ORF Length

115

Open Reading Frame (ORF)

MHQCRHENQRGRQDLPGGQGRRHCPALHHPPALPVYHTHLLQFDGEGGWKFEKLGSASRLSLTEEKQRLEQQLVGIPKMQQHLQELCQILGEAAAPAHVPAPSPQGPGGLQGAST

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.295242

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9067

PhyloCSF Frame 3

0

CNTI Score

-0.28078736