McDonnell Genome Institute

Washington University

Transcript

lnc-TP53RK-5:1

Chromosome

chr20

Gene Name

lnc-TP53RK-5

Start

46863562

CPC Label

noncoding

End

46864104

Cancer

EOGC

Strand

-

Peptide

LATQLTRPLMPIR

Modified Peptide

n[145]LATQLTRPLM[147]PIR

Peptide Length

13

ORF Length

46

Open Reading Frame (ORF)

LATQLTRPLMPIRNFYKKEKTRAIIEEEKNVIVFASLHMAHTNAQM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.130016

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4144

PhyloCSF Frame 3

0

CNTI Score

-0.365290314