McDonnell Genome Institute

Washington University

Transcript

lnc-TP53I11-7:1

Chromosome

chr11

Gene Name

lnc-TP53I11-7

Start

44628633

CPC Label

noncoding

End

44630576

Cancer

OV

Strand

-

Peptide

MPIGHGELAPHPQNFFLFCNYSKR

Modified Peptide

n[145]MPIGHGELAPHPQNFFLFCNYSKR

Peptide Length

24

ORF Length

41

Open Reading Frame (ORF)

LTIRRAPFGGKMPIGHGELAPHPQNFFLFCNYSKRLHFVFL

Conservation Score

0.783

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.192265

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8432

PhyloCSF Frame 3

0

CNTI Score

-0.346053264