McDonnell Genome Institute

Washington University

Transcript

lnc-TOX3-8:1

Chromosome

chr16

Gene Name

lnc-TOX3-8

Start

52198011

CPC Label

noncoding

End

52227956

Cancer

CCRC

Strand

-

Peptide

GGIPMLK

Modified Peptide

n[230]GGIPM[147]LK

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

LLYSWSTQERNVKRGGIPMLKGTLPSDSLYKEPTSPQEDPPICRERKYSFICKLTKLDL

Conservation Score

0.072

PhyloCSF Frame 1

-5.406

No. of Spectra

21

CPC Coding Probability

0.0176487

PhyloCSF Frame 2 

-4.126

CNTI Index

noncoding

Max Probability

0.9934

PhyloCSF Frame 3

-4.984

CNTI Score

-0.407075942