McDonnell Genome Institute

Washington University

Transcript

lnc-TOX3-4:1

Chromosome

chr16

Gene Name

lnc-TOX3-4

Start

52803146

CPC Label

noncoding

End

52828351

Cancer

OV

Strand

-

Peptide

LVMMSQPYHVQPLK

Modified Peptide

n[145]LVMMSQPYHVQPLK

Peptide Length

14

ORF Length

46

Open Reading Frame (ORF)

LVMMSQPYHVQPLKSWTSLFSPLHLNFLNCPNEKDNLVSINKPGHF

Conservation Score

0.51

PhyloCSF Frame 1

-5.674

No. of Spectra

7

CPC Coding Probability

0.0163659

PhyloCSF Frame 2 

-4.116

CNTI Index

noncoding

Max Probability

0.7072

PhyloCSF Frame 3

-5.442

CNTI Score

-0.387450113