McDonnell Genome Institute

Washington University

Transcript

lnc-TOPAZ1-3:1

Chromosome

chr3

Gene Name

lnc-TOPAZ1-3

Start

44338782

CPC Label

noncoding

End

44341425

Cancer

HCC

Strand

+

Peptide

GTISLEK

Modified Peptide

n[230]GTISLEK

Peptide Length

7

ORF Length

72

Open Reading Frame (ORF)

LPELKGTISLEKTFLSSPRPIPSVASGSFSYSVHVCIIAFTALFYTYLLVSVFTLPPPSKSLLSIRIVLIIF

Conservation Score

0.193

PhyloCSF Frame 1

-4.817

No. of Spectra

24

CPC Coding Probability

0.0694516

PhyloCSF Frame 2 

-3.594

CNTI Index

noncoding

Max Probability

0.9648

PhyloCSF Frame 3

-3.232

CNTI Score

-0.38111169