McDonnell Genome Institute

Washington University

Transcript

lnc-TOPAZ1-1:1

Chromosome

chr3

Gene Name

lnc-TOPAZ1-1

Start

44005437

CPC Label

noncoding

End

44120308

Cancer

OV

Strand

+

Peptide

NSPVTEDPR

Modified Peptide

n[145]NSPVTEDPR

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

MIDILLKVSASPNSGKNSPVTEDPRLQNPGTRLSSSGLAAAAPLQTLAS

Conservation Score

0.599

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0529053

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5084

PhyloCSF Frame 3

0

CNTI Score

-0.299285641