McDonnell Genome Institute

Washington University

Transcript

lnc-TOP3B-1:2

Chromosome

chr22

Gene Name

lnc-TOP3B-1

Start

21991099

CPC Label

coding

End

22043934

Cancer

OV

Strand

-

Peptide

FIPDWLEGPQHCLAHTIPTQR

Modified Peptide

n[145]FIPDWLEGPQHCLAHTIPTQR

Peptide Length

21

ORF Length

169

Open Reading Frame (ORF)

LSRTAQSLSYPLLLRGHRAPFMQITPLPLLSLGLNLGKVECGVGLEEPLLLLGGPSCWAPESTEQRAQGRGPGPGFPVETPTDPQGQATLPSTVSEPRFIPDWLEGPQHCLAHTIPTQRQRSRPSTPTPGSLCCRCSPQHISRCKMGLLSMKSSSASSPFRFLCGWGHR

Conservation Score

0.312

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.99995

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.4585

PhyloCSF Frame 3

0

CNTI Score

0.781717174