McDonnell Genome Institute

Washington University

Transcript

lnc-TOP3A-1:1

Chromosome

chr17

Gene Name

lnc-TOP3A-1

Start

18119167

CPC Label

coding

End

18357257

Cancer

BRCA-Luminal A

Strand

-

Peptide

EAPVTTHLSQGPPSIR

Modified Peptide

n[145]EAPVTTHLSQGPPSIR

Peptide Length

16

ORF Length

119

Open Reading Frame (ORF)

LREAPVTTHLSQGPPSIRLEFHLECGSQAWAGHPSEGLPTLHPSWGSRRTPGSVFPLCNEESGSLDPEPLTLTYSRILQPRGLQRAAKTLRKQEALIWGRVSRRQEELQRPGCAVEQDG

Conservation Score

1

PhyloCSF Frame 1

-1.52

No. of Spectra

12

CPC Coding Probability

0.988187

PhyloCSF Frame 2 

-4.19

CNTI Index

noncoding

Max Probability

0.9813

PhyloCSF Frame 3

0.042

CNTI Score

-0.217427831