McDonnell Genome Institute

Washington University

Transcript

lnc-TOP2B-2:1

Chromosome

chr3

Gene Name

lnc-TOP2B-2

Start

25570960

CPC Label

noncoding

End

25572503

Cancer

OV

Strand

-

Peptide

YHQHPSALHPMLTK

Modified Peptide

n[145]YHQHPSALHPMLTK

Peptide Length

14

ORF Length

51

Open Reading Frame (ORF)

LRSHLGLCWPQIPWAPLWACSWSPLLCYRYHQHPSALHPMLTKNCSKAPPL

Conservation Score

0.024

PhyloCSF Frame 1

-4.054

No. of Spectra

6

CPC Coding Probability

0.185797

PhyloCSF Frame 2 

-3.452

CNTI Index

noncoding

Max Probability

0.8861

PhyloCSF Frame 3

-4.846

CNTI Score

-0.290162638