McDonnell Genome Institute

Washington University

Transcript

lnc-TOP2A-1:1

Chromosome

chr17

Gene Name

lnc-TOP2A-1

Start

40439466

CPC Label

noncoding

End

40439917

Cancer

BRCA-Basal-like

Strand

-

Peptide

LDHYAITK

Modified Peptide

n[145]LDHYAITK

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LRLRRQPKYPQKSAPRRNKLDHYAITKFPLTTESAMKKIEDNNTLVFIVNVKANKH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.160318

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8735

PhyloCSF Frame 3

0

CNTI Score

0.707813527