McDonnell Genome Institute

Washington University

Transcript

lnc-TOP1-4:2

Chromosome

chr20

Gene Name

lnc-TOP1-4

Start

41017584

CPC Label

noncoding

End

41018733

Cancer

OV

Strand

+

Peptide

VGTDPVGLDSVLWEENILR

Modified Peptide

n[145]VGTDPVGLDSVLWEENILR

Peptide Length

19

ORF Length

41

Open Reading Frame (ORF)

LFCQAPFQAPIADPGKVGTDPVGLDSVLWEENILRGLHEPS

Conservation Score

0.993

PhyloCSF Frame 1

-5.531

No. of Spectra

13

CPC Coding Probability

0.0244731

PhyloCSF Frame 2 

-5.863

CNTI Index

noncoding

Max Probability

0.5393

PhyloCSF Frame 3

-5.338

CNTI Score

-0.401375792