McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM70-4:4

Chromosome

chr3

Gene Name

lnc-TOMM70-4

Start

100333300

CPC Label

noncoding

End

100334635

Cancer

EOGC

Strand

-

Peptide

LLSSRPYCLSLPK

Modified Peptide

n[145]LLSSRPYCLSLPK

Peptide Length

13

ORF Length

76

Open Reading Frame (ORF)

LGLQAHTTTPSYFFSFFLFLSFFLFFFFLSFLLLIEVGPCYFAQAGLKLLSSRPYCLSLPKCWNYRRELLRPAYRL

Conservation Score

0.025

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0172181

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9281

PhyloCSF Frame 3

0

CNTI Score

-0.366517678