McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM7-6:2

Chromosome

chr7

Gene Name

lnc-TOMM7-6

Start

22620692

CPC Label

noncoding

End

22629746

Cancer

OV

Strand

-

Peptide

ELAPMIMEADK

Modified Peptide

n[145]ELAPMIMEADK

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

MYICVYIYIYKEIYYKELAPMIMEADKCQDLQSESEI

Conservation Score

0.058

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0795113

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5389

PhyloCSF Frame 3

0

CNTI Score

-0.427588874