McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM7-6:1

Chromosome

chr7

Gene Name

lnc-TOMM7-6

Start

22616484

CPC Label

coding

End

22632058

Cancer

OV

Strand

-

Peptide

LAMSAISTMLQLQNLEDVLNR

Modified Peptide

n[145]LAM[147]SAISTM[147]LQLQNLEDVLNR

Peptide Length

21

ORF Length

34

Open Reading Frame (ORF)

LAMSAISTMLQLQNLEDVLNRVAGCVFEWQDFFL

Conservation Score

0.643

PhyloCSF Frame 1

-4.684

No. of Spectra

2

CPC Coding Probability

0.733537

PhyloCSF Frame 2 

-5.011

CNTI Index

noncoding

Max Probability

0.8473

PhyloCSF Frame 3

-3.2

CNTI Score

-0.384256393