McDonnell Genome Institute

Washington University

Transcript

lnc-TOMM7-1:1

Chromosome

chr7

Gene Name

lnc-TOMM7-1

Start

22725394

CPC Label

noncoding

End

22727620

Cancer

OV

Strand

-

Peptide

MVSLAGGSLVSCK

Modified Peptide

n[145]M[147]VSLAGGSLVSCK

Peptide Length

13

ORF Length

42

Open Reading Frame (ORF)

LNLLPRRHPRISYWVKLVQKPSSLRMVSLAGGSLVSCKWALD

Conservation Score

0.792

PhyloCSF Frame 1

-5.3

No. of Spectra

4

CPC Coding Probability

0.0462717

PhyloCSF Frame 2 

-5.854

CNTI Index

noncoding

Max Probability

0.8222

PhyloCSF Frame 3

-5.91

CNTI Score

-0.396018188